Lineage for d1lla_1 (1lla 2-109)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154633Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
  4. 154634Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
  5. 154635Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 154636Protein Hemocyanin, N-terminal domain [48052] (2 species)
  7. 154637Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries)
  8. 154638Domain d1lla_1: 1lla 2-109 [18485]
    Other proteins in same PDB: d1lla_2, d1lla_3

Details for d1lla_1

PDB Entry: 1lla (more details), 2.2 Å

PDB Description: crystal structure of deoxygenated limulus polyphemus subunit ii hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation

SCOP Domain Sequences for d1lla_1:

Sequence, based on SEQRES records: (download)

>d1lla_1 a.85.1.1 (2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus)}
lhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhly
evfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvp

Sequence, based on observed residues (ATOM records): (download)

>d1lla_1 a.85.1.1 (2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus)}
lhdkqirichlfeqlssathsdrlknvgklqpgaifscfhpdhleearhlyevfweagdf
ndfieiakeartfvneglfafaaevavlhrddckglyvp

SCOP Domain Coordinates for d1lla_1:

Click to download the PDB-style file with coordinates for d1lla_1.
(The format of our PDB-style files is described here.)

Timeline for d1lla_1: