SCOP 1.61: Domain d1lla_1: 1lla 2-109

Lineage for d1lla_1 (1lla 2-109)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)

4. Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family)

5. Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)

6. Protein Hemocyanin, N-terminal domain [48052] (2 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries)

8. Domain d1lla_1: 1lla 2-109 [18485]
   Other proteins in same PDB: d1lla_2, d1lla_3

Details for d1lla_1

PDB Entry: 1lla, 2.2 Å

PDB Description: crystal structure of deoxygenated limulus polyphemus subunit ii hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation

SCOP Domain Sequences for d1lla_1:

Sequence, based on SEQRES records:

>d1lla_1 a.85.1.1 (2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus)}
lhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhly
evfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvp

Sequence, based on observed residues (ATOM records):

>d1lla_1 a.85.1.1 (2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus)}
lhdkqirichlfeqlssathsdrlknvgklqpgaifscfhpdhleearhlyevfweagdf
ndfieiakeartfvneglfafaaevavlhrddckglyvp

Timeline for d1lla_1:

• d1lla_1 first appeared (with stable ids) in SCOP 1.55
  
• d1lla_1 appears in SCOP 1.59
  
• d1lla_1 appears in SCOP 1.63
  
• d1lla_1 appears in the current release, SCOPe 2.08, called d1llaa1