Lineage for d1llaa1 (1lla A:2-109)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719399Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
    6 helices; bundle; one central helix is surrounded by 5 others
  4. 2719400Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
    automatically mapped to Pfam PF03722
  5. 2719401Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 2719402Protein Hemocyanin, N-terminal domain [48052] (2 species)
    Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 2719403Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries)
  8. 2719404Domain d1llaa1: 1lla A:2-109 [18485]
    Other proteins in same PDB: d1llaa2, d1llaa3
    complexed with cl, cu, na

Details for d1llaa1

PDB Entry: 1lla (more details), 2.18 Å

PDB Description: crystal structure of deoxygenated limulus polyphemus subunit ii hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation
PDB Compounds: (A:) hemocyanin (subunit type II)

SCOPe Domain Sequences for d1llaa1:

Sequence, based on SEQRES records: (download)

>d1llaa1 a.85.1.1 (A:2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
lhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhly
evfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvp

Sequence, based on observed residues (ATOM records): (download)

>d1llaa1 a.85.1.1 (A:2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
lhdkqirichlfeqlssathsdrlknvgklqpgaifscfhpdhleearhlyevfweagdf
ndfieiakeartfvneglfafaaevavlhrddckglyvp

SCOPe Domain Coordinates for d1llaa1:

Click to download the PDB-style file with coordinates for d1llaa1.
(The format of our PDB-style files is described here.)

Timeline for d1llaa1: