Lineage for d3r8ca1 (3r8c A:2-218)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114499Species Mycobacterium abscessus [TaxId:561007] [189689] (2 PDB entries)
  8. 2114500Domain d3r8ca1: 3r8c A:2-218 [184845]
    Other proteins in same PDB: d3r8ca2, d3r8cb2
    automated match to d1q3ta_

Details for d3r8ca1

PDB Entry: 3r8c (more details), 2.2 Å

PDB Description: crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d3r8ca1:

Sequence, based on SEQRES records: (download)

>d3r8ca1 c.37.1.0 (A:2-218) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaatdqv
pmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaessgav
vvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqrrdhlds
travsplrpaedalevdtsdmtqeqvvahlldlvrtr

Sequence, based on observed residues (ATOM records): (download)

>d3r8ca1 c.37.1.0 (A:2-218) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaatdqv
pmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaessgav
vvegrdigtvvlpdadvkiyltasaqaraqrrnladvqrrdhlplrpaedalevdtsdmt
qeqvvahlldlvrtr

SCOPe Domain Coordinates for d3r8ca1:

Click to download the PDB-style file with coordinates for d3r8ca1.
(The format of our PDB-style files is described here.)

Timeline for d3r8ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r8ca2