SCOPe 2.03: Domain d3r85d_: 3r85 D:

Lineage for d3r85d_ (3r85 D:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (29 PDB entries)

8. Domain d3r85d_: 3r85 D: [184843]
   automated match to d1g5ja_
   complexed with so4

Details for d3r85d_

PDB Entry: 3r85, 1.95 Å

PDB Description: crystal structure of human soul bh3 domain in complex with bcl-xl

PDB Compounds: (D:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3r85d_:

Sequence; same for both SEQRES and ATOM records:

>d3r85d_ f.1.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitpgt
ayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhl
epwiqenggwdtfvelygn

Timeline for d3r85d_:

• d3r85d_ first appeared in SCOPe 2.01
  
• d3r85d_ appears in SCOPe 2.02
  
• d3r85d_ appears in SCOPe 2.04
  
• d3r85d_ appears in the current release, SCOPe 2.08