SCOPe 2.05: Domain d3r7xb_: 3r7x B:

Lineage for d3r7xb_ (3r7x B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein automated matches [190140] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189406] (2 PDB entries)

8. Domain d3r7xb_: 3r7x B: [184839]
   automated match to d1mm6a_
   complexed with glu, qsn

Details for d3r7xb_

PDB Entry: 3r7x, 2.1 Å

PDB Description: crystal structure analysis of a quinazolinedione sulfonamide bound to human glur2: a novel class of competitive ampa receptor antagonists with oral activity

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3r7xb_:

Sequence; same for both SEQRES and ATOM records:

>d3r7xb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlklneq
glldklknkwwydkgec

Timeline for d3r7xb_:

• d3r7xb_ first appeared in SCOPe 2.01
  
• d3r7xb_ appears in SCOPe 2.04
  
• d3r7xb_ appears in SCOPe 2.06
  
• d3r7xb_ appears in the current release, SCOPe 2.08