Lineage for d3r7xb_ (3r7x B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009303Protein automated matches [190140] (10 species)
    not a true protein
  7. 1009347Species Human (Homo sapiens) [TaxId:9606] [189406] (2 PDB entries)
  8. 1009351Domain d3r7xb_: 3r7x B: [184839]
    automated match to d1mm6a_
    complexed with glu, qsn

Details for d3r7xb_

PDB Entry: 3r7x (more details), 2.1 Å

PDB Description: crystal structure analysis of a quinazolinedione sulfonamide bound to human glur2: a novel class of competitive ampa receptor antagonists with oral activity
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3r7xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r7xb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlklneq
glldklknkwwydkgec

SCOPe Domain Coordinates for d3r7xb_:

Click to download the PDB-style file with coordinates for d3r7xb_.
(The format of our PDB-style files is described here.)

Timeline for d3r7xb_: