Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein automated matches [190140] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189406] (2 PDB entries) |
Domain d3r7xb_: 3r7x B: [184839] automated match to d1mm6a_ complexed with glu, qsn |
PDB Entry: 3r7x (more details), 2.1 Å
SCOPe Domain Sequences for d3r7xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r7xb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlklneq glldklknkwwydkgec
Timeline for d3r7xb_: