Lineage for d3r77b_ (3r77 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122006Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2122007Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2122008Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)
  6. 2122021Protein Phenazine biosynthesis protein PhzD [89643] (2 species)
  7. 2122025Species Pseudomonas fluorescens [TaxId:294] [189688] (1 PDB entry)
  8. 2122027Domain d3r77b_: 3r77 B: [184836]
    automated match to d1nf8a_
    complexed with cl, qli; mutant

Details for d3r77b_

PDB Entry: 3r77 (more details), 1.9 Å

PDB Description: Crystal structure of the D38A mutant of isochorismatase PhzD from Pseudomonas fluorescens 2-79 in complex with 2-amino-2-desoxyisochorismate ADIC
PDB Compounds: (B:) Probable isochorismatase

SCOPe Domain Sequences for d3r77b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r77b_ c.33.1.3 (B:) Phenazine biosynthesis protein PhzD {Pseudomonas fluorescens [TaxId: 294]}
mtgipsivpyalptsrdlpanlaqwhidperavllvhamqryflrplpdalrdqvvgnaa
rirqwaadngvpvaytaqpgsmneeqrgllkdfwgpgmkasptdrevvdalapqpgdwll
tkwrysaffnsdllqrlhasgrdqlilcgvyahvgvlissvdaysndiqpflvadaiadf
skehhwmameyaasrcamvittdevv

SCOPe Domain Coordinates for d3r77b_:

Click to download the PDB-style file with coordinates for d3r77b_.
(The format of our PDB-style files is described here.)

Timeline for d3r77b_: