SCOPe 2.08: Domain d3r77b_: 3r77 B:

Lineage for d3r77b_ (3r77 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)

6. Protein Phenazine biosynthesis protein PhzD [89643] (2 species)

7. Species Pseudomonas fluorescens [TaxId:294] [189688] (1 PDB entry)

8. Domain d3r77b_: 3r77 B: [184836]
   automated match to d1nf8a_
   complexed with cl, qli; mutant

Details for d3r77b_

PDB Entry: 3r77, 1.9 Å

PDB Description: Crystal structure of the D38A mutant of isochorismatase PhzD from Pseudomonas fluorescens 2-79 in complex with 2-amino-2-desoxyisochorismate ADIC

PDB Compounds: (B:) Probable isochorismatase

SCOPe Domain Sequences for d3r77b_:

Sequence; same for both SEQRES and ATOM records:

>d3r77b_ c.33.1.3 (B:) Phenazine biosynthesis protein PhzD {Pseudomonas fluorescens [TaxId: 294]}
mtgipsivpyalptsrdlpanlaqwhidperavllvhamqryflrplpdalrdqvvgnaa
rirqwaadngvpvaytaqpgsmneeqrgllkdfwgpgmkasptdrevvdalapqpgdwll
tkwrysaffnsdllqrlhasgrdqlilcgvyahvgvlissvdaysndiqpflvadaiadf
skehhwmameyaasrcamvittdevv

Timeline for d3r77b_:

• d3r77b_ first appeared in SCOPe 2.01
  
• d3r77b_ appears in SCOPe 2.07