Class a: All alpha proteins [46456] (289 folds) |
Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily) core: 6 helices; one central helix is surrounded by 5 others |
Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) automatically mapped to Pfam PF02925 |
Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein) |
Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species) |
Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries) |
Domain d1cd33_: 1cd3 3: [18483] Other proteins in same PDB: d1cd3f_, d1cd3g_ |
PDB Entry: 1cd3 (more details), 3.5 Å
SCOPe Domain Sequences for d1cd33_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd33_ a.84.1.1 (3:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]} teqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtld fvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaft lrvragntdvltdaeenvrq
Timeline for d1cd33_: