Lineage for d1cd33_ (1cd3 3:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002003Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
    core: 6 helices; one central helix is surrounded by 5 others
  4. 2002004Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) (S)
    automatically mapped to Pfam PF02925
  5. 2002005Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)
  6. 2002006Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)
  7. 2002007Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries)
  8. 2002015Domain d1cd33_: 1cd3 3: [18483]
    Other proteins in same PDB: d1cd3f_, d1cd3g_

Details for d1cd33_

PDB Entry: 1cd3 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174
PDB Compounds: (3:) protein (scaffolding protein gpd)

SCOPe Domain Sequences for d1cd33_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd33_ a.84.1.1 (3:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]}
teqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtld
fvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaft
lrvragntdvltdaeenvrq

SCOPe Domain Coordinates for d1cd33_:

Click to download the PDB-style file with coordinates for d1cd33_.
(The format of our PDB-style files is described here.)

Timeline for d1cd33_: