![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily) core: 6 helices; one central helix is surrounded by 5 others |
![]() | Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) ![]() automatically mapped to Pfam PF02925 |
![]() | Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein) |
![]() | Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species) |
![]() | Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries) |
![]() | Domain d1cd32_: 1cd3 2: [18482] Other proteins in same PDB: d1cd3f_, d1cd3g_ |
PDB Entry: 1cd3 (more details), 3.5 Å
SCOPe Domain Sequences for d1cd32_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd32_ a.84.1.1 (2:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]} eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl rvragntdvltdaee
Timeline for d1cd32_: