SCOPe 2.06: Domain d3r69a1: 3r69 A:241-327

Lineage for d3r69a1 (3r69 A:241-327)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189959] (13 PDB entries)

8. Domain d3r69a1: 3r69 A:241-327 [184815]
   Other proteins in same PDB: d3r69a2, d3r69b2
   automated match to d1gq5a_
   complexed with cit

Details for d3r69a1

PDB Entry: 3r69, 1.5 Å

PDB Description: molecular analysis of the interaction of the hdl-receptor sr-bi with the pdz3 domain of its adaptor protein pdzk1

PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF3, Scavenger receptor class B member 1

SCOPe Domain Sequences for d3r69a1:

Sequence, based on SEQRES records:

>d3r69a1 b.36.1.0 (A:241-327) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvvikkgsngygfylragpeqkgqiikdiepgspaeaaglknndlvvavngksveald
hdgvvemirkggdqttllvldkqeakl

Sequence, based on observed residues (ATOM records):

>d3r69a1 b.36.1.0 (A:241-327) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvvikkgsngygfylragpgqiikdiepgspaeaaglknndlvvavngksvealdhdg
vvemirkggdqttllvldkqeakl

Timeline for d3r69a1:

• d3r69a1 first appeared in SCOPe 2.01, called d3r69a_
  
• d3r69a1 was called d3r69a_ in SCOPe 2.05
  
• d3r69a1 appears in SCOPe 2.07
  
• d3r69a1 appears in the current release, SCOPe 2.08