SCOP 1.63: Domain d1cd31_: 1cd3 1:

Lineage for d1cd31_ (1cd3 1:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
   core: 6 helices; one central helix is surrounded by 5 others

4. Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family)

5. Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)

6. Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [48048] (2 PDB entries)

8. Domain d1cd31_: 1cd3 1: [18481]
   Other proteins in same PDB: d1cd3f_, d1cd3g_

Details for d1cd31_

PDB Entry: 1cd3, 3.5 Å

PDB Description: procapsid of bacteriophage phix174

SCOP Domain Sequences for d1cd31_:

Sequence; same for both SEQRES and ATOM records:

>d1cd31_ a.84.1.1 (1:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltdaeenvrqklra

Timeline for d1cd31_:

• d1cd31_ first appeared (with stable ids) in SCOP 1.55
  
• d1cd31_ appears in SCOP 1.61
  
• d1cd31_ appears in SCOP 1.65
  
• d1cd31_ appears in the current release, SCOPe 2.08