Lineage for d3r4pa1 (3r4p A:9-225)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2579779Protein HSP90 [55876] (3 species)
  7. 2579883Species Human (Homo sapiens) [TaxId:9606] [55878] (146 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2579901Domain d3r4pa1: 3r4p A:9-225 [184806]
    Other proteins in same PDB: d3r4pa2, d3r4pb2
    automated match to d1osfa_
    complexed with fu7, po4

Details for d3r4pa1

PDB Entry: 3r4p (more details), 1.7 Å

PDB Description: Optimization of potent, selective, and orally bioavailable pyrrolodinopyrimidine-containing inhibitors of heat shock protein 90. identification of development candidate 2-amino-4-{4-chloro-2-[2-(4-fluoro-1H-pyrazol-1-yl)ethoxy]-6-methylphenyl}-N-(2,2-difluoropropyl)-5,7-dihydro-6H-pyrrolo[3,4-d]pyrimidine-6-carboxamide
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3r4pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r4pa1 d.122.1.1 (A:9-225) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfveke

SCOPe Domain Coordinates for d3r4pa1:

Click to download the PDB-style file with coordinates for d3r4pa1.
(The format of our PDB-style files is described here.)

Timeline for d3r4pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r4pa2