| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
| Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
| Protein HSP90 [55876] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries) Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223 |
| Domain d3r4ob1: 3r4o B:17-225 [184805] Other proteins in same PDB: d3r4oa2, d3r4ob2 automated match to d1osfa_ complexed with fu3 |
PDB Entry: 3r4o (more details), 2.65 Å
SCOPe Domain Sequences for d3r4ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r4ob1 d.122.1.1 (B:17-225) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfveke
Timeline for d3r4ob1: