Lineage for d3r4la_ (3r4l A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568351Protein automated matches [190484] (2 species)
    not a true protein
  7. 2568352Species Human (Homo sapiens) [TaxId:9606] [188559] (17 PDB entries)
  8. 2568377Domain d3r4la_: 3r4l A: [184800]
    automated match to d1c5ga_
    complexed with bma, fuc, nag, ndg

Details for d3r4la_

PDB Entry: 3r4l (more details), 2.7 Å

PDB Description: human very long half life plasminogen activator inhibitor type-1
PDB Compounds: (A:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d3r4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r4la_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaam
gfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvk
qvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngcwktpfpds
sthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapye
kevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqf
qadftslsdqeplhvaqalqkvkievnesctvassstavivsarmapeeiimdrpflfvv
rhnptgtvlfmgqvmep

SCOPe Domain Coordinates for d3r4la_:

Click to download the PDB-style file with coordinates for d3r4la_.
(The format of our PDB-style files is described here.)

Timeline for d3r4la_: