Lineage for d1al04_ (1al0 4:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719385Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
    core: 6 helices; one central helix is surrounded by 5 others
  4. 2719386Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) (S)
    automatically mapped to Pfam PF02925
  5. 2719387Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)
  6. 2719388Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)
  7. 2719389Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries)
  8. 2719398Domain d1al04_: 1al0 4: [18480]
    Other proteins in same PDB: d1al0f_, d1al0g_

Details for d1al04_

PDB Entry: 1al0 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174
PDB Compounds: (4:) scaffolding protein gpd

SCOPe Domain Sequences for d1al04_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1al04_ a.84.1.1 (4:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]}
qsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldfv
gyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftlr
vragntdvltdaeenvrqklraegvm

SCOPe Domain Coordinates for d1al04_:

Click to download the PDB-style file with coordinates for d1al04_.
(The format of our PDB-style files is described here.)

Timeline for d1al04_: