Lineage for d3r4ca_ (3r4c A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1883904Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)
  8. 1883924Domain d3r4ca_: 3r4c A: [184799]
    automated match to d1ymqa1
    complexed with mg, so4

Details for d3r4ca_

PDB Entry: 3r4c (more details), 1.82 Å

PDB Description: Divergence of Structure and Function Among Phosphatases of the Haloalkanoate (HAD) Enzyme Superfamily: Analysis of BT1666 from Bacteroides thetaiotaomicron
PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like hydrolase

SCOPe Domain Sequences for d3r4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r4ca_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
ssglvprgshmikvllldvdgtllsfethkvsqssidalkkvhdsgikiviatgraasdl
heidavpydgvialngaecvlrdgsvirkvaipaqdfrksmelarefdfavalelnegvf
vnrltptveqiagivehpvppvvdieemferkeccqlcfyfdeeaeqkvmpllsglsatr
whplfadvnvagtskatglslfadyyrvkvseimacgdggndipmlkaagigvamgnase
kvqsvadfvtdtvdnsglykalkhfgvi

SCOPe Domain Coordinates for d3r4ca_:

Click to download the PDB-style file with coordinates for d3r4ca_.
(The format of our PDB-style files is described here.)

Timeline for d3r4ca_: