SCOPe 2.03: Domain d1al03_: 1al0 3:

Lineage for d1al03_ (1al0 3:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
   core: 6 helices; one central helix is surrounded by 5 others

4. Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family)
   automatically mapped to Pfam PF02925

5. Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)

6. Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries)

8. Domain d1al03_: 1al0 3: [18479]
   Other proteins in same PDB: d1al0f_, d1al0g_

Details for d1al03_

PDB Entry: 1al0, 3.5 Å

PDB Description: procapsid of bacteriophage phix174

PDB Compounds: (3:) scaffolding protein gpd

SCOPe Domain Sequences for d1al03_:

Sequence; same for both SEQRES and ATOM records:

>d1al03_ a.84.1.1 (3:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]}
teqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtld
fvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaft
lrvragntdvltdaeenvrq

Timeline for d1al03_:

• d1al03_ first appeared (with stable ids) in SCOP 1.55
  
• d1al03_ appears in SCOPe 2.02
  
• d1al03_ appears in SCOPe 2.04
  
• d1al03_ appears in the current release, SCOPe 2.08