Lineage for d1al03_ (1al0 3:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
    core: 6 helices; one central helix is surrounded by 5 others
  4. Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) (S)
    automatically mapped to Pfam PF02925
  5. Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)
  6. Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)
  7. Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries)
  8. Domain d1al03_: 1al0 3: [18479]
    Other proteins in same PDB: d1al0f_, d1al0g_

Details for d1al03_

PDB Entry: 1al0 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174
PDB Compounds: (3:) scaffolding protein gpd

SCOPe Domain Sequences for d1al03_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1al03_ a.84.1.1 (3:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]}
teqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtld
fvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaft
lrvragntdvltdaeenvrq

SCOPe Domain Coordinates for d1al03_ are not available.

Timeline for d1al03_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1al01_, d1al02_, d1al04_, d1al0f_, d1al0g_