SCOPe 2.06: Domain d3r2nc_: 3r2n C:

Lineage for d3r2nc_ (3r2n C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (12 species)
   not a true protein

7. Species Mycobacterium leprae [TaxId:561304] [189682] (1 PDB entry)

8. Domain d3r2nc_: 3r2n C: [184787]
   Other proteins in same PDB: d3r2nd2
   automated match to d1r5ta_
   complexed with edo, gol, zn

Details for d3r2nc_

PDB Entry: 3r2n, 2.3 Å

PDB Description: crystal structure of cytidine deaminase from mycobacterium leprae

PDB Compounds: (C:) Cytidine deaminase

SCOPe Domain Sequences for d3r2nc_:

Sequence; same for both SEQRES and ATOM records:

>d3r2nc_ c.97.1.0 (C:) automated matches {Mycobacterium leprae [TaxId: 561304]}
dvnwdtlqkaavaaransyapysnfpvgvagfvndgrlitgvnvenasyglalcaecsmi
salyatgggrlvavycvdgngdslmpcgrcrqllyehggpelkimtpkgvqtmaqllpq

Timeline for d3r2nc_:

• d3r2nc_ first appeared in SCOPe 2.01
  
• d3r2nc_ appears in SCOPe 2.05
  
• d3r2nc_ appears in SCOPe 2.07
  
• d3r2nc_ appears in the current release, SCOPe 2.08