Lineage for d3r2nc_ (3r2n C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882436Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1882437Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1882645Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 1882646Protein automated matches [190746] (11 species)
    not a true protein
  7. 1882675Species Mycobacterium leprae [TaxId:561304] [189682] (1 PDB entry)
  8. 1882678Domain d3r2nc_: 3r2n C: [184787]
    automated match to d1r5ta_
    complexed with edo, gol, zn

Details for d3r2nc_

PDB Entry: 3r2n (more details), 2.3 Å

PDB Description: crystal structure of cytidine deaminase from mycobacterium leprae
PDB Compounds: (C:) Cytidine deaminase

SCOPe Domain Sequences for d3r2nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r2nc_ c.97.1.0 (C:) automated matches {Mycobacterium leprae [TaxId: 561304]}
dvnwdtlqkaavaaransyapysnfpvgvagfvndgrlitgvnvenasyglalcaecsmi
salyatgggrlvavycvdgngdslmpcgrcrqllyehggpelkimtpkgvqtmaqllpq

SCOPe Domain Coordinates for d3r2nc_:

Click to download the PDB-style file with coordinates for d3r2nc_.
(The format of our PDB-style files is described here.)

Timeline for d3r2nc_: