Lineage for d3r2ka_ (3r2k A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704605Species Pseudomonas aeruginosa [TaxId:287] [189971] (7 PDB entries)
  8. 2704606Domain d3r2ka_: 3r2k A: [184782]
    automated match to d1sofa1
    complexed with na

Details for d3r2ka_

PDB Entry: 3r2k (more details), 1.55 Å

PDB Description: 1.55A resolution structure of As-Isolated FtnA from Pseudomonas aeruginosa (pH 7.5)
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d3r2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r2ka_ a.25.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mqghpevidylntlltgelaardqyfihsrmyedwgfsklyerlnhemeeetqhadallr
rilllegtprmrpddihpgttvpemleadlklerhvraalakgialceqhkdfvsrdilk
aqladteedhaywleqqlgliarmglenylqsqi

SCOPe Domain Coordinates for d3r2ka_:

Click to download the PDB-style file with coordinates for d3r2ka_.
(The format of our PDB-style files is described here.)

Timeline for d3r2ka_: