SCOPe 2.01: Domain d3r2ha_: 3r2h A:

Lineage for d3r2ha_ (3r2h A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189971] (7 PDB entries)

8. Domain d3r2ha_: 3r2h A: [184781]
   automated match to d1sofa1
   complexed with cxs, na

Details for d3r2ha_

PDB Entry: 3r2h, 1.7 Å

PDB Description: 1.7 A resolution structure of As-Isolated FtnA from Pseudomonas aeruginosa (pH 10.5)

PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d3r2ha_:

Sequence; same for both SEQRES and ATOM records:

>d3r2ha_ a.25.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mqghpevidylntlltgelaardqyfihsrmyedwgfsklyerlnhemeeetqhadallr
rilllegtprmrpddihpgttvpemleadlklerhvraalakgialceqhkdfvsrdilk
aqladteedhaywleqqlgliarmglenylqsqi

Timeline for d3r2ha_:

• d3r2ha_ is new in SCOPe 2.01-stable
  
• d3r2ha_ appears in SCOPe 2.02
  
• d3r2ha_ appears in the current release, SCOPe 2.08