SCOPe 2.02: Domain d1al02_: 1al0 2:

Lineage for d1al02_ (1al0 2:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
   core: 6 helices; one central helix is surrounded by 5 others

4. Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family)

5. Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)

6. Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries)

8. Domain d1al02_: 1al0 2: [18478]
   Other proteins in same PDB: d1al0f_, d1al0g_

Details for d1al02_

PDB Entry: 1al0, 3.5 Å

PDB Description: procapsid of bacteriophage phix174

PDB Compounds: (2:) scaffolding protein gpd

SCOPe Domain Sequences for d1al02_:

Sequence; same for both SEQRES and ATOM records:

>d1al02_ a.84.1.1 (2:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltda

Timeline for d1al02_:

• d1al02_ first appeared (with stable ids) in SCOP 1.55
  
• d1al02_ appears in SCOPe 2.01
  
• d1al02_ appears in SCOPe 2.03
  
• d1al02_ appears in the current release, SCOPe 2.08