Lineage for d3r29a_ (3r29 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009236Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2009237Species Human (Homo sapiens) [TaxId:9606] [48511] (35 PDB entries)
    Uniprot P19793 227-458
  8. 2009297Domain d3r29a_: 3r29 A: [184779]
    automated match to d1lbda_

Details for d3r29a_

PDB Entry: 3r29 (more details), 2.9 Å

PDB Description: Crystal structure of RXRalpha ligand-binding domain complexed with corepressor SMRT2
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d3r29a_:

Sequence, based on SEQRES records: (download)

>d3r29a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmeml

Sequence, based on observed residues (ATOM records): (download)

>d3r29a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepkdpvtnicqaadkqlftlvewakriphfselplddqvillra
gwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmd
ktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlp
alrsiglkclehlfffkligdtpidtflmeml

SCOPe Domain Coordinates for d3r29a_:

Click to download the PDB-style file with coordinates for d3r29a_.
(The format of our PDB-style files is described here.)

Timeline for d3r29a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3r29b_