| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
| Protein automated matches [190140] (10 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [189211] (9 PDB entries) |
| Domain d3r26a_: 3r26 A: [184778] automated match to d1amfa_ complexed with reo |
PDB Entry: 3r26 (more details), 1.7 Å
SCOPe Domain Sequences for d3r26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r26a_ c.94.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gkitvfaaasltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadqkw
mdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdpeh
vpagiyakealqklgawdtlspklapaedvrgalalverneaplgivygsdavaskgvkv
vatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik
Timeline for d3r26a_: