Lineage for d3r20a_ (3r20 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366433Species Mycobacterium smegmatis [TaxId:246196] [189426] (2 PDB entries)
  8. 1366434Domain d3r20a_: 3r20 A: [184777]
    automated match to d1q3ta_
    complexed with cl, dpo, edo, so4

Details for d3r20a_

PDB Entry: 3r20 (more details), 2 Å

PDB Description: crystal structure of cytidylate kinase from mycobacterium smegmatis
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d3r20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r20a_ c.37.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
slvvavdgpagtgkssvsrglaralgaryldtgamyriatlavlragadltdpaaiekaa
adaeigvgsdpdvdaaflagedvsseirgdavtgavsavsavpavrtrlvdiqrklateg
grvvvegrdigtvvlpdadvkifltasaeerarrrnaqnvanglpddyatvladvqrrdh
ldstrpvsplraaddalvvdtsdmdqaqviahlldlv

SCOPe Domain Coordinates for d3r20a_:

Click to download the PDB-style file with coordinates for d3r20a_.
(The format of our PDB-style files is described here.)

Timeline for d3r20a_: