Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (4 species) not a true protein |
Species Mycobacterium avium [TaxId:243243] [189899] (1 PDB entry) |
Domain d3r1ja_: 3r1j A: [184775] automated match to d1oija_ complexed with cl, edo, fe |
PDB Entry: 3r1j (more details), 2.05 Å
SCOPe Domain Sequences for d3r1ja_:
Sequence, based on SEQRES records: (download)
>d3r1ja_ b.82.2.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]} itvtklgsrigarvdgvrlggdlddatveqirrallthkviffrhqhhlddsrqlefarl lgtpighpaasalaakhlpvitpidseygkatrwhtdvtfaanypaasilravtlpsygg stlwastvaayqqlpeplrhltenlwalhtnrydyvrndpmndtqrafrqafekpdfrte hpvvrvhpetgerallagdfvrgfvgldghessvllellqrritmpentvrwswapgdva mwdnratqhraiddyddqprlmhritlmgdvpvnvhgersrvisgaplevla
>d3r1ja_ b.82.2.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]} itvtklgsrigarvdgvrlggdlddatveqirrallthkviffrhqhhlddsrqlefarl lgtpigatrwhtdvtfaanypaasilravtlpsyggstlwastvaayqqlpeplrhlten lwalhtnrpdfrtehpvvrvhpetgerallagdfvrgfvgldghessvllellqrritmp entvrwswapgdvamwdnratqhraiddyddqprlmhritlmgdvpvnvhgersrvisga plevla
Timeline for d3r1ja_: