SCOPe 2.08: Domain d3r13a1: 3r13 A:1-247

Lineage for d3r13a1 (3r13 A:1-247)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)

7. Species Thermotoga maritima [TaxId:2336] [82270] (3 PDB entries)
   TM1559

8. Domain d3r13a1: 3r13 A:1-247 [184770]
   Other proteins in same PDB: d3r13a2, d3r13b2
   automated match to d1o0ya_
   complexed with act, gol, unl

Details for d3r13a1

PDB Entry: 3r13, 1.83 Å

PDB Description: crystal structure of a deoxyribose-phosphate aldolase (tm_1559) from thermotoga maritima at 1.83 a resolution

PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d3r13a1:

Sequence; same for both SEQRES and ATOM records:

>d3r13a1 c.1.10.1 (A:1-247) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]}
mieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikklclearenr
fhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesgadeidmvi
nvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvisklagahfvkt
stgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigtssgvkivq
ggeeryg

Timeline for d3r13a1:

• d3r13a1 first appeared in SCOPe 2.01, called d3r13a_
  
• d3r13a1 appears in SCOPe 2.07