Lineage for d1al01_ (1al0 1:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283490Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
    core: 6 helices; one central helix is surrounded by 5 others
  4. 283491Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) (S)
  5. 283492Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)
  6. 283493Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)
  7. 283494Species Bacteriophage phi-X174 [TaxId:10847] [48048] (2 PDB entries)
  8. 283495Domain d1al01_: 1al0 1: [18477]
    Other proteins in same PDB: d1al0f_, d1al0g_

Details for d1al01_

PDB Entry: 1al0 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174

SCOP Domain Sequences for d1al01_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1al01_ a.84.1.1 (1:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltdaeenvrqklra

SCOP Domain Coordinates for d1al01_:

Click to download the PDB-style file with coordinates for d1al01_.
(The format of our PDB-style files is described here.)

Timeline for d1al01_: