Lineage for d3r0pc_ (3r0p C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032070Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1032250Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 1032251Protein automated matches [190935] (4 species)
    not a true protein
  7. 1032288Species uncultured organism [TaxId:155900] [189680] (1 PDB entry)
  8. 1032291Domain d3r0pc_: 3r0p C: [184762]
    automated match to d1qd9a_

Details for d3r0pc_

PDB Entry: 3r0p (more details), 1.9 Å

PDB Description: Crystal structure of L-PSP putative endoribonuclease from uncultured organism
PDB Compounds: (C:) L-PSP putative endoribonuclease

SCOPe Domain Sequences for d3r0pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0pc_ d.79.1.0 (C:) automated matches {uncultured organism [TaxId: 155900]}
mtnkaiihsdnapaaigtysqavkvnntvylsgqipldpvtmqlvegdfavqahqvfknl
ravceaaggglrdivklnvyltdlanfpivnevmgqyfqapyparaaiginqlpraslie
adgimvi

SCOPe Domain Coordinates for d3r0pc_:

Click to download the PDB-style file with coordinates for d3r0pc_.
(The format of our PDB-style files is described here.)

Timeline for d3r0pc_: