Lineage for d1bg0_1 (1bg0 2-95)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215648Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 215649Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) (S)
  5. 215650Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 215651Protein Arginine kinase, N-domain [48042] (1 species)
  7. 215652Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (3 PDB entries)
  8. 215654Domain d1bg0_1: 1bg0 2-95 [18476]
    Other proteins in same PDB: d1bg0_2
    complexed with adp, mg, no3

Details for d1bg0_1

PDB Entry: 1bg0 (more details), 1.86 Å

PDB Description: transition state structure of arginine kinase

SCOP Domain Sequences for d1bg0_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg0_1 a.83.1.1 (2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus)}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOP Domain Coordinates for d1bg0_1:

Click to download the PDB-style file with coordinates for d1bg0_1.
(The format of our PDB-style files is described here.)

Timeline for d1bg0_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bg0_2