Lineage for d1bg0_1 (1bg0 2-95)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154590Fold a.83: Guanido kinases [48033] (1 superfamily)
  4. 154591Superfamily a.83.1: Guanido kinases [48034] (1 family) (S)
  5. 154592Family a.83.1.1: Guanido kinases [48035] (2 proteins)
  6. 154593Protein Arginine kinase [48042] (1 species)
  7. 154594Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (1 PDB entry)
  8. 154595Domain d1bg0_1: 1bg0 2-95 [18476]
    Other proteins in same PDB: d1bg0_2

Details for d1bg0_1

PDB Entry: 1bg0 (more details), 1.86 Å

PDB Description: transition state structure of arginine kinase

SCOP Domain Sequences for d1bg0_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg0_1 a.83.1.1 (2-95) Arginine kinase {Horseshoe crab (Limulus polyphemus)}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOP Domain Coordinates for d1bg0_1:

Click to download the PDB-style file with coordinates for d1bg0_1.
(The format of our PDB-style files is described here.)

Timeline for d1bg0_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bg0_2