Lineage for d3r0fa_ (3r0f A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 954996Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 954997Protein automated matches [190438] (10 species)
    not a true protein
  7. 955020Species Human enterovirus 71 [TaxId:39054] [189708] (3 PDB entries)
  8. 955023Domain d3r0fa_: 3r0f A: [184754]
    automated match to d1l1na_
    complexed with ag7, edo; mutant

Details for d3r0fa_

PDB Entry: 3r0f (more details), 1.31 Å

PDB Description: human enterovirus 71 3c protease mutant h133g in complex with rupintrivir
PDB Compounds: (A:) 3C protein

SCOPe Domain Sequences for d3r0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0fa_ b.47.1.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldav
elvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkptgrtmmynfptkagqcggvvtsvgkiigihiggngrqgfcaglkrsyfa
s

SCOPe Domain Coordinates for d3r0fa_:

Click to download the PDB-style file with coordinates for d3r0fa_.
(The format of our PDB-style files is described here.)

Timeline for d3r0fa_: