Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Human enterovirus 71 [TaxId:39054] [189708] (8 PDB entries) |
Domain d3r0fa_: 3r0f A: [184754] automated match to d1l1na_ complexed with ag7, edo; mutant |
PDB Entry: 3r0f (more details), 1.31 Å
SCOPe Domain Sequences for d3r0fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r0fa_ b.47.1.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]} gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldav elvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv qygflnlsgkptgrtmmynfptkagqcggvvtsvgkiigihiggngrqgfcaglkrsyfa s
Timeline for d3r0fa_: