SCOPe 2.04: Domain d3r02a_: 3r02 A:

Lineage for d3r02a_ (3r02 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (65 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d3r02a_: 3r02 A: [184750]
   automated match to d1xqza_
   complexed with imd, unm

Details for d3r02a_

PDB Entry: 3r02, 1.95 Å

PDB Description: The discovery of novel benzofuran-2-carboxylic acids as potent Pim-1 inhibitors

PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d3r02a_:

Sequence; same for both SEQRES and ATOM records:

>d3r02a_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
esqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllk
kvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvlea
vrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewir
yhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalr
psdrptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d3r02a_:

• d3r02a_ first appeared in SCOPe 2.01
  
• d3r02a_ appears in SCOPe 2.03
  
• d3r02a_ appears in SCOPe 2.05
  
• d3r02a_ appears in the current release, SCOPe 2.08