Class a: All alpha proteins [46456] (289 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
Protein Creatine kinase, N-domain [48036] (7 species) |
Species Cow (Bos taurus), retinal isoform [TaxId:9913] [48041] (1 PDB entry) |
Domain d1g0wa1: 1g0w A:2-102 [18475] Other proteins in same PDB: d1g0wa2 complexed with so4 |
PDB Entry: 1g0w (more details), 2.3 Å
SCOPe Domain Sequences for d1g0wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0wa1 a.83.1.1 (A:2-102) Creatine kinase, N-domain {Cow (Bos taurus), retinal isoform [TaxId: 9913]} pfsnshntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgv dnpghpyimtvgcvagdeesydvfkelfdpiiedrhggykp
Timeline for d1g0wa1: