Lineage for d1g0wa1 (1g0w A:2-102)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5055Fold a.83: Guanido kinases [48033] (1 superfamily)
  4. 5056Superfamily a.83.1: Guanido kinases [48034] (1 family) (S)
  5. 5057Family a.83.1.1: Guanido kinases [48035] (2 proteins)
  6. 5061Protein Creatine kinase, N-terminal domain [48036] (5 species)
  7. 5072Species Cow (Bos taurus), retinal isoform [TaxId:9913] [48041] (1 PDB entry)
  8. 5073Domain d1g0wa1: 1g0w A:2-102 [18475]
    Other proteins in same PDB: d1g0wa2

Details for d1g0wa1

PDB Entry: 1g0w (more details), 2.3 Å

PDB Description: crystal structure of bovine retinal creatine kinase

SCOP Domain Sequences for d1g0wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0wa1 a.83.1.1 (A:2-102) Creatine kinase, N-terminal domain {Cow (Bos taurus), retinal isoform}
pfsnshntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgv
dnpghpyimtvgcvagdeesydvfkelfdpiiedrhggykp

SCOP Domain Coordinates for d1g0wa1:

Click to download the PDB-style file with coordinates for d1g0wa1.
(The format of our PDB-style files is described here.)

Timeline for d1g0wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g0wa2