Lineage for d1g0wa1 (1g0w A:2-102)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719236Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 2719264Protein Creatine kinase, N-domain [48036] (7 species)
  7. 2719275Species Cow (Bos taurus), retinal isoform [TaxId:9913] [48041] (1 PDB entry)
  8. 2719276Domain d1g0wa1: 1g0w A:2-102 [18475]
    Other proteins in same PDB: d1g0wa2
    complexed with so4

Details for d1g0wa1

PDB Entry: 1g0w (more details), 2.3 Å

PDB Description: crystal structure of bovine retinal creatine kinase
PDB Compounds: (A:) creatine kinase

SCOPe Domain Sequences for d1g0wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0wa1 a.83.1.1 (A:2-102) Creatine kinase, N-domain {Cow (Bos taurus), retinal isoform [TaxId: 9913]}
pfsnshntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgv
dnpghpyimtvgcvagdeesydvfkelfdpiiedrhggykp

SCOPe Domain Coordinates for d1g0wa1:

Click to download the PDB-style file with coordinates for d1g0wa1.
(The format of our PDB-style files is described here.)

Timeline for d1g0wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g0wa2