SCOPe 2.08: Domain d1g0wa1: 1g0w A:2-102

Lineage for d1g0wa1 (1g0w A:2-102)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Cow (Bos taurus), retinal isoform [TaxId:9913] [48041] (1 PDB entry)

8. Domain d1g0wa1: 1g0w A:2-102 [18475]
   Other proteins in same PDB: d1g0wa2
   complexed with so4

Details for d1g0wa1

PDB Entry: 1g0w, 2.3 Å

PDB Description: crystal structure of bovine retinal creatine kinase

PDB Compounds: (A:) creatine kinase

SCOPe Domain Sequences for d1g0wa1:

Sequence; same for both SEQRES and ATOM records:

>d1g0wa1 a.83.1.1 (A:2-102) Creatine kinase, N-domain {Cow (Bos taurus), retinal isoform [TaxId: 9913]}
pfsnshntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgv
dnpghpyimtvgcvagdeesydvfkelfdpiiedrhggykp

Timeline for d1g0wa1:

• d1g0wa1 first appeared (with stable ids) in SCOP 1.55
  
• d1g0wa1 appears in SCOPe 2.07