SCOP 1.73: Domain d2crka1: 2crk A:8-102

Lineage for d2crka1 (2crk A:8-102)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family)

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48040] (2 PDB entries)

8. Domain d2crka1: 2crk A:8-102 [18474]
   Other proteins in same PDB: d2crka2
   complexed with so4

Details for d2crka1

PDB Entry: 2crk, 2.35 Å

PDB Description: muscle creatine kinase

PDB Compounds: (A:) protein (creatine kinase)

SCOP Domain Sequences for d2crka1:

Sequence; same for both SEQRES and ATOM records:

>d2crka1 a.83.1.1 (A:8-102) Creatine kinase, N-domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
nkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgvdnpghp
fimtvgcvagdeesytvfkdlfdpiiqdrhggfkp

Timeline for d2crka1:

• d2crka1 first appeared (with stable ids) in SCOP 1.55
  
• d2crka1 appears in SCOP 1.71
  
• d2crka1 appears in SCOP 1.75
  
• d2crka1 appears in the current release, SCOPe 2.08