Lineage for d2crka1 (2crk A:8-102)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49442Fold a.83: Guanido kinases [48033] (1 superfamily)
  4. 49443Superfamily a.83.1: Guanido kinases [48034] (1 family) (S)
  5. 49444Family a.83.1.1: Guanido kinases [48035] (2 proteins)
  6. 49448Protein Creatine kinase, N-terminal domain [48036] (5 species)
  7. 49470Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48040] (1 PDB entry)
  8. 49471Domain d2crka1: 2crk A:8-102 [18474]
    Other proteins in same PDB: d2crka2

Details for d2crka1

PDB Entry: 2crk (more details), 2.35 Å

PDB Description: muscle creatine kinase

SCOP Domain Sequences for d2crka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crka1 a.83.1.1 (A:8-102) Creatine kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
nkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgvdnpghp
fimtvgcvagdeesytvfkdlfdpiiqdrhggfkp

SCOP Domain Coordinates for d2crka1:

Click to download the PDB-style file with coordinates for d2crka1.
(The format of our PDB-style files is described here.)

Timeline for d2crka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2crka2