| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
| Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
| Protein Creatine kinase, N-domain [48036] (7 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48040] (2 PDB entries) |
| Domain d2crka1: 2crk A:8-102 [18474] Other proteins in same PDB: d2crka2 complexed with so4 |
PDB Entry: 2crk (more details), 2.35 Å
SCOPe Domain Sequences for d2crka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2crka1 a.83.1.1 (A:8-102) Creatine kinase, N-domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
nkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgvdnpghp
fimtvgcvagdeesytvfkdlfdpiiqdrhggfkp
Timeline for d2crka1: