SCOPe 2.06: Domain d3qzpb1: 3qzp B:62-184

Lineage for d3qzpb1 (3qzp B:62-184)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein automated matches [191246] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries)

8. Domain d3qzpb1: 3qzp B:62-184 [184735]
   Other proteins in same PDB: d3qzpa2, d3qzpb2
   automated match to d2o1aa1
   complexed with coh, gol, so4

Details for d3qzpb1

PDB Entry: 3qzp, 1.9 Å

PDB Description: Staphylococcus aureus IsdA NEAT domain in complex with cobalt-protoporphyrin IX

PDB Compounds: (B:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d3qzpb1:

Sequence; same for both SEQRES and ATOM records:

>d3qzpb1 b.1.28.1 (B:62-184) automated matches {Staphylococcus aureus [TaxId: 158879]}
sqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfyna
nnqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaip
tla

Timeline for d3qzpb1:

• d3qzpb1 first appeared in SCOPe 2.01, called d3qzpb_
  
• d3qzpb1 was called d3qzpb_ in SCOPe 2.05
  
• d3qzpb1 appears in SCOPe 2.07
  
• d3qzpb1 appears in the current release, SCOPe 2.08