| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
| Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
| Protein automated matches [191246] (3 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries) |
| Domain d3qzpa1: 3qzp A:62-184 [184734] Other proteins in same PDB: d3qzpa2, d3qzpb2 automated match to d2o1aa1 complexed with coh, gol, so4 |
PDB Entry: 3qzp (more details), 1.9 Å
SCOPe Domain Sequences for d3qzpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qzpa1 b.1.28.1 (A:62-184) automated matches {Staphylococcus aureus [TaxId: 158879]}
sqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfyna
nnqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaip
tla
Timeline for d3qzpa1: