Lineage for d3qzod_ (3qzo D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771461Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1771462Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 1771485Protein automated matches [191246] (3 species)
    not a true protein
  7. 1771486Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries)
  8. 1771495Domain d3qzod_: 3qzo D: [184733]
    automated match to d2o1aa1
    complexed with gol, hem

Details for d3qzod_

PDB Entry: 3qzo (more details), 1.95 Å

PDB Description: Staphylococcus aureus IsdA NEAT domain in complex with heme, reduced crystal
PDB Compounds: (D:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d3qzod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qzod_ b.1.28.1 (D:) automated matches {Staphylococcus aureus [TaxId: 158879]}
msqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfyn
annqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekai
ptla

SCOPe Domain Coordinates for d3qzod_:

Click to download the PDB-style file with coordinates for d3qzod_.
(The format of our PDB-style files is described here.)

Timeline for d3qzod_: