Lineage for d3qznb_ (3qzn B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766796Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2766819Protein automated matches [191246] (3 species)
    not a true protein
  7. 2766820Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries)
  8. 2766831Domain d3qznb_: 3qzn B: [184728]
    automated match to d2o1aa1
    complexed with gol, hem, so4

Details for d3qznb_

PDB Entry: 3qzn (more details), 2 Å

PDB Description: Staphylococcus aureus IsdA NEAT domain Y166A variant in complex with heme
PDB Compounds: (B:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d3qznb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qznb_ b.1.28.1 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]}
atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
qelattvvndnkkadtrtinvavepgykslttkvhivvpqinanhrytthlefekaiptl
a

SCOPe Domain Coordinates for d3qznb_:

Click to download the PDB-style file with coordinates for d3qznb_.
(The format of our PDB-style files is described here.)

Timeline for d3qznb_: