![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
![]() | Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
![]() | Protein automated matches [191246] (3 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries) |
![]() | Domain d3qznb_: 3qzn B: [184728] automated match to d2o1aa1 complexed with gol, hem, so4 |
PDB Entry: 3qzn (more details), 2 Å
SCOPe Domain Sequences for d3qznb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qznb_ b.1.28.1 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]} atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann qelattvvndnkkadtrtinvavepgykslttkvhivvpqinanhrytthlefekaiptl a
Timeline for d3qznb_: