SCOPe 2.08: Domain d3qzmb_: 3qzm B:

Lineage for d3qzmb_ (3qzm B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein automated matches [191246] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries)

8. Domain d3qzmb_: 3qzm B: [184726]
   Other proteins in same PDB: d3qzma2
   automated match to d2o1aa1
   complexed with gol, hem, so4

Details for d3qzmb_

PDB Entry: 3qzm, 1.25 Å

PDB Description: staphylococcus aureus isda neat domain h83a variant in complex with heme

PDB Compounds: (B:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d3qzmb_:

Sequence; same for both SEQRES and ATOM records:

>d3qzmb_ b.1.28.1 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]}
sqatsqpinfqvqkdgsseksamddymqhpgkvikqnnkyyfqtvlnnasfwkeykfyna
nnqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaip
tla

Timeline for d3qzmb_:

• d3qzmb_ first appeared in SCOPe 2.01
  
• d3qzmb_ appears in SCOPe 2.07