SCOPe 2.01: Domain d3qzma_: 3qzm A:

Lineage for d3qzma_ (3qzm A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (1 family)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein automated matches [191246] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries)

8. Domain d3qzma_: 3qzm A: [184725]
   automated match to d2o1aa1
   complexed with gol, hem, so4

Details for d3qzma_

PDB Entry: 3qzm, 1.25 Å

PDB Description: staphylococcus aureus isda neat domain h83a variant in complex with heme

PDB Compounds: (A:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d3qzma_:

Sequence; same for both SEQRES and ATOM records:

>d3qzma_ b.1.28.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
msqatsqpinfqvqkdgsseksamddymqhpgkvikqnnkyyfqtvlnnasfwkeykfyn
annqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekai
ptla

Timeline for d3qzma_:

• d3qzma_ is new in SCOPe 2.01-stable
  
• d3qzma_ appears in SCOPe 2.02
  
• d3qzma_ appears in the current release, SCOPe 2.08, called d3qzma1