SCOPe 2.08: Domain d3qzma1: 3qzm A:62-184

Lineage for d3qzma1 (3qzm A:62-184)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein automated matches [191246] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries)

8. Domain d3qzma1: 3qzm A:62-184 [184725]
   Other proteins in same PDB: d3qzma2
   automated match to d2o1aa1
   complexed with gol, hem, so4

Details for d3qzma1

PDB Entry: 3qzm, 1.25 Å

PDB Description: staphylococcus aureus isda neat domain h83a variant in complex with heme

PDB Compounds: (A:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d3qzma1:

Sequence; same for both SEQRES and ATOM records:

>d3qzma1 b.1.28.1 (A:62-184) automated matches {Staphylococcus aureus [TaxId: 158879]}
sqatsqpinfqvqkdgsseksamddymqhpgkvikqnnkyyfqtvlnnasfwkeykfyna
nnqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaip
tla

Timeline for d3qzma1:

• d3qzma1 first appeared in SCOPe 2.01, called d3qzma_
  
• d3qzma1 appears in SCOPe 2.07